hiring customer service representatives that are a perfect fit

customer service new rules for a social media world

customer service new rules for a social media world

... and leave it at that You also want to fight back against everyone who’s saying bad things about you That s totally understandable It’s human nature The problem is that rarely works If you that, ... if you can use them as a testimonial Turn a fan into a raving fan And enjoy it The Prima Donna A prima donna is a customer who feels that he has a big enough following in social media to use ... media plan is critical to your company’s success • Awareness—You’ve shown that you’re familiar with the potential pitfalls of social media; you’re making sure that your company’s roadmap has ways...

Ngày tải lên: 24/08/2014, 15:53

203 1K 1
A Perfect Fit

A Perfect Fit

... was “Afraid of what?” She smiled, though it was half-hearted at best “Partly afraid he’ll say something that will make it hard to stay mad at him, and partly that he won’t find a way to explain ... trays of lasagna, a huge green salad and a loaf of garlic bread were laid out on the enormous kitchen island An assortment of sodas and water bottles sat nearby Delphi came up the stairs as Cami ... a hand to her hair, all too aware it wasn’t as perfect as she liked “Yes It’s been a crazy week, and the extra sleep was definitely needed Sage and I are going to be around for the holiday Anything...

Ngày tải lên: 28/05/2015, 15:07

163 412 0
Tài liệu Báo cáo khoa học: Transactivation properties of c-Myb are critically dependent on two SUMO-1 acceptor sites that are conjugated in a PIASy enhanced manner pptx

Tài liệu Báo cáo khoa học: Transactivation properties of c-Myb are critically dependent on two SUMO-1 acceptor sites that are conjugated in a PIASy enhanced manner pptx

... sumoylation and desumoylation are needed for viability in yeast [27] Because several different classes of proteins are targets for SUMO-1 conjugation, it is rather unlikely that a single explanation ... determination of reporter activation using both a 5-bromo-4-chlorindol-3-yl b-D-galactoside overlay and a liquid b-galactosidase assay (Fig 3) Similar analysis of several subdomains of c-Myb revealed ... M and S) This might give a larger fraction of unsumoylated c-Myb in M than is actually the case in vivo We conclude that PIASy enhances sumoylation of c-Myb significantly, and that sumoylated and...

Ngày tải lên: 21/02/2014, 00:20

11 557 0
Báo cáo khoa học: Cytosolic phospholipase A2-a and cyclooxygenase-2 localize to intracellular membranes of EA.hy.926 endothelial cells that are distinct from the endoplasmic reticulum and the Golgi apparatus pdf

Báo cáo khoa học: Cytosolic phospholipase A2-a and cyclooxygenase-2 localize to intracellular membranes of EA.hy.926 endothelial cells that are distinct from the endoplasmic reticulum and the Golgi apparatus pdf

... the calcium-induced relocation of cPLA2 -a in EA.hy.926 endothelial cells We show that cPLA2 -a relocates to intracellular membrane compartments that are distinct from the ER and the Golgi apparatus ... studies demonstrated that this interaction was necessary for cPLA2 -a- mediated arachidonic acid release, and suggested that vimentin may function as an adapter protein for FEBS Journal 272 (2005) ... FEBS cPLA2 -a at its site of localization Several studies have also implied that cPLA2 -a may be regulated by cytoskeletal interactions Cytochalasin B, an inhibitor of actin polymerization, was shown...

Ngày tải lên: 16/03/2014, 18:20

13 388 0
Báo cáo khoa học: A profile of the residues in the second extracellular loop that are critical for ligand recognition of human prostacyclin receptor pdf

Báo cáo khoa học: A profile of the residues in the second extracellular loop that are critical for ligand recognition of human prostacyclin receptor pdf

... Pharmacia Biotech (Piscataway, NJ, USA) DNA polymerase and DpnI endonuclease were obtained from Stratagene (La Jolla, CA, USA) Rabbit anti-(human IP) serum was purchased from Cayman Chemical (Ann ... designed on the basis of human IP cDNA with specific modifications The primer sequences used were 5¢-ATTCTCGAGATGGCGGAT TCGTGCAGGAAC-3¢ (forward) and 5¢-AAGAATTCA CAGGGTCAGCTTGAAATGTCAG-3¢ (reverse), ... that after replacement of R173 with an Ala residue (R17 3A) , IP loses ligand-binding activity [16]; and (d) it has also been reported that the mutant with replacement of P179 by Ala (P17 9A) has...

Ngày tải lên: 23/03/2014, 07:20

10 354 0
Báo cáo khoa học: Nuclear aggregates of polyamines are supramolecular structures that play a crucial role in genomic DNA protection and conformation potx

Báo cáo khoa học: Nuclear aggregates of polyamines are supramolecular structures that play a crucial role in genomic DNA protection and conformation potx

... cycle, particularly the S-phase [21] Temperature is an additional factor capable of affecting DNA conformation It has been reported that (a) an increase of a few °C is associated with a reduction ... Saminathan M, Thomas T, Shirahata A, Pillai KS & Thomas TJ (2002) Polyamine structural effects on the induction and stabilization of liquid crystalline DNA, potential applications to DNA packaging, ... Luccia A (2002) Polyamines interact with DNA as molecular aggregates Eur J Biochem 269, 4317–4325 30 Saminathan M, Antony T, Shirahata A, Sigal LH, Thomas T & Thomas TJ (1999) Ionic and structural...

Ngày tải lên: 23/03/2014, 15:20

11 380 0
Surviving Customer Service A Frontline Employee Field Guide potx

Surviving Customer Service A Frontline Employee Field Guide potx

... conversation At the publishing company I had a call come in late on a Friday afternoon Any call that came in late on a Friday was going to be a user of our assistive technology that was a guarantee ... I am prone to using any surface as a table Art and color escape me completely You may have a knack for organizing a space and making a room “warm” You may have a talent for replicating the master ... over and grab a plate If you are at a computer learn Alt + Tab Learn all the shortcuts you can, but Alt + Tab is a good one Take walks and use your break time It is important get out and away from...

Ngày tải lên: 01/04/2014, 01:21

45 384 0
Chapter 2Communicating Over the Network Quangkien@gmail.com.OverviewDescribe the structure of a network, including the devices and media that are necessary for successful communications. Explain the function of protocols in network communications. Ex potx

Chapter 2Communicating Over the Network Quangkien@gmail.com.OverviewDescribe the structure of a network, including the devices and media that are necessary for successful communications. Explain the function of protocols in network communications. Ex potx

... The amount of data and the speed at which it must be transmitted – The cost of the media and installation 17 Local Area Network (LAN) Local Area Network (LAN) An individual network usually spans ... setup and termination of data transfer sessions 25 Message uses Multiple protocols (encapsulated) HTTP Header Protocols Frame Header IP Header Data App TCP Header Header Frame Trailer Data Message: ... Data Multiple protocols 26 Multiple protocols (encapsulated) HTTP Header Protocols Frame Header IP Header Data App TCP Header Header Frame Trailer Data Encapsulation – Process of adding a header...

Ngày tải lên: 01/04/2014, 12:20

52 550 0
assessing a customer service model in the financial services industry

assessing a customer service model in the financial services industry

... courteous and competent customer relations, and customer satisfaction and customer service are essential to maintaining positive relations (Carraher, Carraher, & Mintu-Wimsatt, 2005) Carraher et al ... vs Account Control Tech (as cited in “ACA International’s Guide,” 200 5a) , a collection agency repeatedly contacted a customer after it was warned that the customer had retained an attorney; and ... not to call at work, and (c) after they have retained an attorney A search of the literature indicated that contacting customers after they have retained an attorney was a frequent infraction by...

Ngày tải lên: 03/06/2014, 00:52

241 569 0
Perfect Phrases for Customer Service.Also available from McGraw-Hill potx

Perfect Phrases for Customer Service.Also available from McGraw-Hill potx

... faster.” Face-Saving Out Embarrassing or humiliating a customer is always a bad thing, even in situations where the customer has made a stupid mistake or is angry and unpleasant Providing a face-saving ... customer that you are paying attention and that you believe that the customer and what he or 20 Customer Service Tools and Techniques she has to say are important Active listening involves rephrasing ... the people who pay to eat in a restaurant, pay for health care and legal advice, or pay to stay in a hotel Second, there are internal customers These are people who receive output (services, products,...

Ngày tải lên: 28/06/2014, 17:21

240 476 1
Báo cáo y học: "Expert agreement confirms that negative changes in hand and foot radiographs are a surrogate for repair in patients with rheumatoid arthritis" pot

Báo cáo y học: "Expert agreement confirms that negative changes in hand and foot radiographs are a surrogate for repair in patients with rheumatoid arthritis" pot

... indicated that readers were able to accurately recognize a single feature or a combination of features that was interpreted as repair in many cases Assignment of the correct sequence was significantly ... cases that are equivocal The analysis that excluded these cases indicates that where there is a clear-cut difference between images at two time points at intervals of months to years, the panel's ... appraisal of repair on a group level is a relatively simple statistical matter, translating repair from the group level to an individual patient is not straightforward The null hypothesis that...

Ngày tải lên: 09/08/2014, 10:20

9 374 0
Báo cáo y học: "APOBEC3G induces a hypermutation gradient: purifying selection at multiple steps during HIV-1 replication results in levels of G-to-A mutations that are high in DNA, intermediate in cellular viral RNA, and low in virion RNA" pps

Báo cáo y học: "APOBEC3G induces a hypermutation gradient: purifying selection at multiple steps during HIV-1 replication results in levels of G-to-A mutations that are high in DNA, intermediate in cellular viral RNA, and low in virion RNA" pps

... Vif was amplified using the forward primer YRHHYmutF, 5'GGAAAGCTAAGGACTGGT TTGCTGCAGCTGCCGCTGAAAGTACTAATCCAAAAATA AG3', and the reverse primer VifR, 5'GGATAAACAGCAGT TGTTGC3' The resulting amplicons ... pressure was operating against genomes that had inactivating mutations in the gag gene The observation that a few of the viral RNA-derived sequences had inactivating mutations in the gag gene strongly ... mutation frequency of all the vif and vpr sequence data obtained from the viral DNA, cRNA, and vRNA from each infection (YA, YB and YC) at Rounds and are shown in Fig 3G and Table A total of 139 sequences...

Ngày tải lên: 13/08/2014, 05:21

15 320 0
Báo cáo y học: " Amino acid residues that are important for Hyal2 function as a receptor for jaagsiekte sheep retrovirus" potx

Báo cáo y học: " Amino acid residues that are important for Hyal2 function as a receptor for jaagsiekte sheep retrovirus" potx

... LQTHFRCQCYLGWGGEQCQWDRRRAAGGASGAWAGSHLTGLLAVAVLAFTWTS LQTHFRCQCYLGWSGEQCQWDHRQAAGGASEAWAGSHLTSLLALAALAFTWTL LQKHFRCQCYLGWGGEQCQRNYKGAAGNASRAWAGSHLTSLLGLVAVALTWTL LQMHFRCHCYLGWGGEQCQWNHKRAAGDASRAWAGAHLASLLGLVAMTLTWTL ... chimeric, and mutant receptors, analyzed the data, and drafted the manuscript All authors read and approved the final manuscript Additional material Additional File "Hyal2 DNA sequences.fasta" Bovine ... from that of human Hyal2 We also made a human Hyal2 mutant that contained all three of these mutations, and this mutant had 6% of the activity of human Hyal2 (average of two experiments, data not...

Ngày tải lên: 13/08/2014, 09:21

11 247 0
Báo cáo y học: "The integrins are a superfamily of cell adhesion receptors that bind to extracellular matrix ligands, cell-surface ligands, and soluble ligands. They are transmembrane α" ppsx

Báo cáo y học: "The integrins are a superfamily of cell adhesion receptors that bind to extracellular matrix ligands, cell-surface ligands, and soluble ligands. They are transmembrane α" ppsx

... 271:20438-20443 Kamata T, Tieu KK, Irie A, Springer TA, Takada Y: Amino acid residues in the alpha IIb subunit that are critical for ligand binding to integrin alpha IIbbeta are clustered in the betapropeller ... example, the focal adhesion kinase/cSrc, and the small GTPases Ras and Rho) and adaptors (for example, Cas/Crk and paxillin) that assemble within dynamic adhesion structures, including focal adhesions ... domain of urokinase-type plasminogen activator (uPA) and integrin alpha v beta induces signal transduction and enhances plasminogen activation Thromb Haemost 2006, 95:524-534 31 Tarui T, Mazar AP,...

Ngày tải lên: 14/08/2014, 07:21

9 356 0
SERVICE QUALITY, PERCEIVED PRICE AND CUSTOMER SATISFACTION IN HIGHER EDUCATION A comparison between Public Universities and Non-public Universities in Vietnam

SERVICE QUALITY, PERCEIVED PRICE AND CUSTOMER SATISFACTION IN HIGHER EDUCATION A comparison between Public Universities and Non-public Universities in Vietnam

... 4.3 - EFA analysis result Nacdm1 Nacdm2 Nacdm3 Nacdm4 Nacdm5 Nacdm6 Nacdm7 Nacdm8 Acadm1 Acadm2 Acadm3 Acadm4 Acadm5 Acadm6 Acadm7 Acadm8 Reptt1 Reptt2 Reptt3 Reptt4 Reptt5 Reptt6 Nacadm Acadm 685 ... students Acadm6 Academic staff communicate well in the classroom Acadm7 Academic staff has a precise method to appraise my studying performance Acadm8 Academic staff are highly educated and experience ... Reputation scale Reptt1 The institution has a professional appearance/image Reptt2 The hostel facilities and equipment are adequate and necessary Reptt3 Academic facilities are adequate and necessary...

Ngày tải lên: 01/06/2015, 20:20

75 424 0
Customer satisfaction and loyalty after service failure and recovery  a study in restaurant industry in ho chi minh city of vietnam

Customer satisfaction and loyalty after service failure and recovery a study in restaurant industry in ho chi minh city of vietnam

... are increasingly seen as factors that may separate the more successful organizations from the others While organizations could be aware of the impact that organization responses to service failure ... produced after factor analysis due to gabage items Value of Cronbach’s Alpha ranges from to According Hair et al.(1998) any item that have Cronbach’s Alpha of less than 0.6 will be eliminated Reliabilities ... Item-Total Correlation are all >.3, Cronbach's Alpha if Item Deleted of all items are

Ngày tải lên: 22/10/2015, 13:28

87 542 0
Procedural Abstraction and Functions That Return a Value

Procedural Abstraction and Functions That Return a Value

... the formal parameter names  Formal parameters are like placeholders for the actual arguments used when the function is called  Formal parameter names can be any valid identifier Example: double ... parameter names may or may not match variable names used in the main part of the program  It does not matter if formal parameter names match other variable names in the program  Remember that only ... function:  Are local to that function, they cannot be used from outside the function  Have the function as their scope Variables declared in the main part of a program:  Are local to the main part...

Ngày tải lên: 12/09/2012, 22:48

94 541 0
w