cao thủ học đường 3

Trí tuệ học đường 3

Trí tuệ học đường 3

... chất giữa cơ thể với môI trường thuộc loại vận động nào? Đáp án: Vận động sinh học Đáp án : Thụ phấn chéo Câu 3: Lực ma sát nào làm cho viên bi ve đứng yên trên một mặt bàn nhẵn, nằm ngang? Đáp...

Ngày tải lên: 25/06/2013, 01:26

5 450 1
ATGT + nha hoc dương 3

ATGT + nha hoc dương 3

... Người đi trên đường nhỏ (đường huyện ) ra đường quốc lộ phải đi như thế nào ? - Đi bộ trên đường quốc lộ đường tỉnh, Đường quốc lộ, đường tỉnh, đường huyện, đường làng xã, đường đô thị. PP: Trực ... Bài 3: Biển báo hiệu giao thông đường bộ 6 27/9 Bài 4: Kỹ năng đi bộ và qua đường an toàn 7 4/10 Bài 5: Con đường đến trường. CHƯƠNG TRÌNH NHA HỌC ĐƯỜNG 3 An toàn giao thông Bài 1: GIAO THÔNG ĐƯỜNG ... nêu. - nghe đường huyện phải đi như thế nào ? Gv nhận xét và giáo dục hs biết giữ đúng luật giao thông khi đi đường . HĐ4 : Củng cố (3 ) Gv gắn 3 tranh về đường quốc lộ , đường phố, đường xã...

Ngày tải lên: 27/09/2013, 18:10

25 793 5
Nha học đường 3. Bài 1. Tại sao và khi nào chải răng?

Nha học đường 3. Bài 1. Tại sao và khi nào chải răng?

... Tr ng Ti u h c Diên Th ườ ể ọ ọ Giáo án 3 2010 - 2011 TRẦN VĂN HOÀ LUYẾN ...

Ngày tải lên: 29/09/2013, 17:10

1 5,7K 71
Tài liệu Báo cáo khoa học: PC1⁄3, PC2 and PC5⁄6A are targeted to dense core secretory granules by a common mechanism doc

Tài liệu Báo cáo khoa học: PC1⁄3, PC2 and PC5⁄6A are targeted to dense core secretory granules by a common mechanism doc

... pathway. Biochem J 34 9 (Part 3) , 8 43 852. 18 Arnaoutova I, Smith AM, Coates LC, Sharpe JC, Dhanvantari S, Snell CR, Birch NP & Loh YP (20 03) The prohormone processing enzyme PC3 is a lipid raft- associated ... more PC5/6A …ATEESWAEGGFCMLVKKNNLCQRKVLQQLCCKTCTFQG Fc FcPC5/6A 878-915 …ATEESWAEGGFCMLVKKNNLCQRKVLQQL 878-906 …ATEESWAEGGFCMLVKKNNL 878-891 878-915 878-906 878-891 8 83- 915 0 1 2 3 * *** Fold stimulation (+F/-F) …WAEGGFCMLVKKNNLCQRKVLQQLCCKTCTFQG 8 83- 915 -F +FCC-F A BC 878-915 8 83- 915 878-906 878-891 FcPC5/6A Fig. 2. ... targeting of the proprotein convertase PC1 to the regulated secretory pathway. J Biol Chem 275, 4 033 7–4 034 3. 4 Zhou A, Paquet L & Mains RE (1995) Structural ele- ments that direct specific processing...

Ngày tải lên: 18/02/2014, 16:20

9 600 0
Báo cáo khoa học: SAF-3, a novel splice variant of the SAF-1/MAZ/Pur-1 family, is expressed during inflammation pptx

Báo cáo khoa học: SAF-3, a novel splice variant of the SAF-1/MAZ/Pur-1 family, is expressed during inflammation pptx

... repression. J Cell Physiol 2 13, 38 4 39 0. 34 Baylin SB (2002) Mechanisms underlying epigenetically mediated gene silencing in cancer. Semin Cancer Biol 12, 33 1 33 7. 35 Sambrook J & Russell DW ... Biol Chem 274, 430 0– 430 8. 13 Ray A, Fields AP & Ray BK (2000) Activation of transcription factor SAF involves its phosphorylation by protein kinase C. J Biol Chem 275, 39 727 39 733 . 14 Ray BK ... expressed SAF -3 protein (Fig. 3E, lanes 1 and 2). SAF -3 expression was detected at a low level in IL-1b-induced HTB-94 cells using this antibody (Fig. 3E, lanes 3 and 4). Detection of SAF -3 mRNA in...

Ngày tải lên: 07/03/2014, 02:20

11 439 0
Báo cáo khoa học: Fowlicidin-3 is an a-helical cationic host defense peptide with potent antibacterial and lipopolysaccharideneutralizing activities ppt

Báo cáo khoa học: Fowlicidin-3 is an a-helical cationic host defense peptide with potent antibacterial and lipopolysaccharideneutralizing activities ppt

... National Science Foundation (grants MCB0 236 039 and EPS0 236 9 13) , NIH (S10-RR02 239 2), Oklahoma Cen- ter for the Advancement of Science and Technology (grant HR 03- 146), and Oklahoma Agricultural Experi- ment ... (A ˚ ) (residues 19–25) Backbone atoms 0 .34 ± 0. 13 Heavy (nonhydrogen) atoms 1.54 ± 0 .39 Percentage of residues in regions of /–w space Core 64.8% Allowed 33 .4% Generously allowed 1.8% Disallowed ... monocytogenes 19115 2 2 Staph. aureus 259 23 1 2 Staph. aureus (MRSA) 433 00 1 2 Staph. aureus (MRSA) BAA -39 1 1 Y. R. Bommineni et al. Structure and functions of fowlicidin -3 FEBS Journal 274 (2007) 418–428...

Ngày tải lên: 07/03/2014, 11:20

11 496 0
Báo cáo khoa học: BGN16.3, a novel acidic b-1,6-glucanase from mycoparasitic fungus Trichoderma harzianum CECT 2413 ppt

Báo cáo khoa học: BGN16.3, a novel acidic b-1,6-glucanase from mycoparasitic fungus Trichoderma harzianum CECT 2413 ppt

... Biol 26, 131 –140. 27 Dana M, Limon MC, Mejias R, Mach RL, Benitez T, Pintor-Toro JA & Kubicek CP (2001) Regulation of chitinase 33 (chit 33) gene expression in Trichoderma harzianum. Curr Genet 38 , ... Res 105, 769–772. 32 Somogyi M (1952) Notes on sugar determination. J Biol Chem 195, 19– 23. 33 Nelson NJ (1955) Colorimetric analysis of sugars. Meth- ods Enzymol 3, 85–86. 34 Laemmli UK (1970) ... harzianum FEBS Journal 272 (2005) 34 41 34 48 ª 2005 FEBS 34 47 the cloned b-1,6-glucanases confirming BGN16 .3 as a novel enzyme. BGN16 .3 internal peptide showed seven of 13 amino acids identity with a...

Ngày tải lên: 07/03/2014, 21:20

8 327 0
Báo cáo khoa học: The 3¢-UTR of the mRNA coding for the major protein kinase C substrate MARCKS contains a novel CU-rich element interacting with the mRNA stabilizing factors HuD and HuR ppt

Báo cáo khoa học: The 3¢-UTR of the mRNA coding for the major protein kinase C substrate MARCKS contains a novel CU-rich element interacting with the mRNA stabilizing factors HuD and HuR ppt

... 2002, accepted 26 November 2002) Eur. J. Biochem. 270, 35 0 36 5 (20 03) Ó FEBS 20 03 doi:10.1046/j.1 432 -1 033 .20 03. 033 96.x NP-40, 10 m M NaCl, 3 m M MgCl 2 and 10 m M Tris/HCl pH 7.4) prior resuspending ... for transfection of Swiss 3T3 fibro- blasts. Length of the MARCKS 3 -UTR sequences [38 ] of pDK1: 131 0–2597 bp (complete 3 -UTR of MARCKS); pDK2: 131 0– 230 9 bp; pDK8: 131 0–1562 bp. The poly(A) signal ... & Keene, J.D. (19 93) Hel-N1: an autoimmune RNA-binding protein with specificity for 3 uridylate-rich untranslated regions of growth factor mRNAs. Mol. Cell. Biol. 13, 34 94 35 04. 51. Brennan,...

Ngày tải lên: 08/03/2014, 08:20

16 754 0
Báo cáo khoa học: 14-3-3 Proteins regulate glycogen synthase 3b phosphorylation and inhibit cardiomyocyte hypertrophy doc

Báo cáo khoa học: 14-3-3 Proteins regulate glycogen synthase 3b phosphorylation and inhibit cardiomyocyte hypertrophy doc

... isoform-independ- 0 1 3 6 12 24 48 time (h) 14 -3- 3β ζ ε γ 14 -3- 3 14 -3- 3 14 -3- 3 B 14 -3- 3 mRNA 14 -3- 3 protein 18sRNA A βγεζ Fig. 1. (A) Different isoforms of 14 -3- 3 s were expressed in cardio- myocytes. 14 -3- 3f, ... A PKBPKB -ser-9-P Active Inactive GSK3GSK3β PI3KPI3K P NFAT PP NFAT 14 - 3 - 3 14 - 3 - 3 14 - 3 - 3 P NFAT PP NFAT GSK3GSK3β Fig. 7. A working model depicts 14 -3- 3 proteins inhibiting the cardio- myocyte ... anti-14 -3- 3b, anti-14 -3- 3c, anti-14 -3- 3e, 14 -3- 3 Controls cardiomyocyte hypertrophy through GSK3b W. Liao et al. 1852 FEBS Journal 272 (2005) 1845–1854 ª 2005 FEBS anti-14 -3- 3f, anti-eIF-5, anti-GSK3b...

Ngày tải lên: 16/03/2014, 18:20

10 290 0
Báo cáo khoa học: Phosphatidylinositol 3,4,5-trisphosphate modulation in SHIP2-deficient mouse embryonic fibroblasts pot

Báo cáo khoa học: Phosphatidylinositol 3,4,5-trisphosphate modulation in SHIP2-deficient mouse embryonic fibroblasts pot

... PtdIns(4,5)P 2 ) SHIP2+/+ SHIP2-/- A PtdIns (3, 4,5)P 3 levels PtdIns (3, 4,5)P 3 levels +serum 0 0,1 0,2 0 ,3 0,4 0,5 0,6 SHIP2+/+ SHIP2-/- B + IGF-1 Fig. 3. PtdIns (3, 4,5)P 3 levels in serum and IGF-1 stimulated ... 2005 FEBS of [ 32 P]-labelled lipids, we scraped off together the region of the TLC containing both [ 32 P]PtdIns (3, 4,5)P 3 and [ 32 P]PtdIns(4,5)P 2 , the levels of [ 32 P]-labelled 3- phosphoinositides ... IGF-1 1 and 10 n M or PDGF 30 ngÆmL )1 for 5 min. [ 32 P]PtdIns (3, 4,5)P 3 (upper panel) and [ 32 P]PtdIns (3, 4)P 2 (lower panel) are expressed as a percentage of total [ 32 P]PtdIns(4,5)P 2 and are...

Ngày tải lên: 16/03/2014, 19:20

11 303 0
Báo cáo khoa học: The 3-ureidopropionase of Caenorhabditis elegans, an enzyme involved in pyrimidine degradation pptx

Báo cáo khoa học: The 3-ureidopropionase of Caenorhabditis elegans, an enzyme involved in pyrimidine degradation pptx

... Biochem 217, 220– 230 . 36 Bolleter WT, Bushman CJ & Tidwell PW (1961) Spec- trophotometric detection of ammonia as indophenol. Anal Chem 33 , 592–594. 37 Hiller A & van Slyke D (1 933 ) Determination ... instructions. Cloning of 3- ureidopropionase The cDNA of 3- ureidopropionase (gene F13H8.7) was amplified from a cDNA library made of 1 lg of total RNA using primers 3- UP_F (5¢-CATATGTCTGCAGCTCCG GCT -3 ) and 3- UP_R ... Chem 102, 499. 38 Traut TW & Loechel S (1984) Pyrimidine catabolism: individual characterization of the three sequential enzymes with a new assay. Biochemistry 23, 2 533 –2 539 . 3- Ureidopropionase...

Ngày tải lên: 23/03/2014, 03:20

10 494 0

Bạn có muốn tìm thêm với từ khóa:

w