aavp a novel hybrid gene delivery system

Novel CNS gene delivery systems

Novel CNS gene delivery systems

... globus pallidus; SNc, substantia nigra pars compacta; Snr, substantia nigra pars reticulata; Th, thalamus; VTA, ventral tegmental area (adapted from Costantini, 2000) Parkinsonian symptoms may occur ... performance of a vector by improving on the apparent drawbacks and retaining the advantages at the same time The aim of the first part of the research was to evaluate the bioavailability of PPE-EA ... Gene delivery by Naked DNA 2.2.2.1 Naked DNA mediated transfection Significant amount of data indicates that the uptake and expression of naked DNA is a general property of animal cells within a...

Ngày tải lên: 16/09/2015, 15:54

146 182 0
Báo cáo hóa học: " Research Article LCMV Beamforming for a Novel Wireless Local Positioning System: Nonstationarity and Cyclostationarity Analysis" doc

Báo cáo hóa học: " Research Article LCMV Beamforming for a Novel Wireless Local Positioning System: Nonstationarity and Cyclostationarity Analysis" doc

... data j j length for Rq estimation If yq [n] is a stationary and ergodic process, the sample average equals time average, and the sample covariance matrix estimator leads to an accurate estimate ... positioning systems,” in Proceedings of the IEEE Radar Conference (RADAR ’07), Waltham, Mass, USA, April 2007 [6] Z Wang and S A Zekavat, “Manet localization via multi-node TOA-DOA optimal fusion,” ... Transactions on Antennas and Propagation, vol 47, no 2, pp 233–241, 1999 [14] L C Godara, “Application of antenna arrays to mobile communications—part II: beam-forming and direction-ofarrival...

Ngày tải lên: 22/06/2014, 19:20

12 308 0
Báo cáo y học: " Substitution of the Rev-response element in an HIV-1-based gene delivery system with that of SIVmac239 allows efficient delivery of Rev M10 into T-lymphocytes" ppsx

Báo cáo y học: " Substitution of the Rev-response element in an HIV-1-based gene delivery system with that of SIVmac239 allows efficient delivery of Rev M10 into T-lymphocytes" ppsx

... in human T cells by lentiviral-mediated delivery of small interfering RNA against CCR5 Proc Natl Acad Sci U S A 2003, 100:183-188 Srinivasakumar N, Chazal N, Helga-Maria C, Prasad S, Hammarskjold ... Nathaniel Landau for pNL4-3.HSA.R-E- (catalog # 3417) These latter reagents were made available through the NIH AIDS Research and Reference Reagent Program, Division of AIDS, NIAID, NIH The author also ... immediately after the cells were washed (considered day 1) and at 72 h intervals thereafter (days and 7) and assayed for HIV-1 p24 using a commercial ELISA kit (Perkin-Elmer, Boston, MA) List of abbreviations...

Ngày tải lên: 10/08/2014, 05:21

13 357 0
Báo cáo y học: "A novel hybrid aspirin-NO-releasing compound inhibits TNFalpha release from LPS-activated human monocytes and macrophages" docx

Báo cáo y học: "A novel hybrid aspirin-NO-releasing compound inhibits TNFalpha release from LPS-activated human monocytes and macrophages" docx

... translation, and post-translational processing J Immunol 1992, 149:3052-3058 Panwalkar A, Verstovsek S, Giles F: Nuclear factor-kappaB modulation as a therapeutic approach in hematologic malignancies ... studies and on realistic plasma concentrations, where these data are available; 10 μM was deemed a relevant plasma level for aspirin, and so was utilised in this study In order to facilitate direct ... captured with a camera connected to a Zeiss Axiovert S100 microscope using Improvision Openlab 3.1.5 software Images were captured at a magnification of ×100 Statistical analyses Statistical analysis...

Ngày tải lên: 11/08/2014, 08:22

10 365 1
Báo cáo sinh học: "Comparisons of three polyethyleneimine-derived nanoparticles as a gene therapy delivery system for renal cell carcinoma" doc

Báo cáo sinh học: "Comparisons of three polyethyleneimine-derived nanoparticles as a gene therapy delivery system for renal cell carcinoma" doc

... of apoptosis Cancer Gene Ther 2010, 17:212-222 Morikawa T, Sugiyama A, Kume H, Ota S, Kashima T, Tomita K, Kitamura T, Kodama T, Fukayama M, Aburatani H: Identification of Toll-like receptor as ... physic-chemical properties (size and charge) of each separate material, including PCFC-g-PEI and FA-PEAs, as well as the FA-PEAs: pVHL complexes Because PCFC-g-PEI and FA-PEAs are amphiphilic ... cationic HPEI nanogel was conjugated by 2-kD PEI and heparin Heparin is a biodegradable negative polysaccharide with many carboxylic groups, and PEI is a cationic polymer with many primary amine...

Ngày tải lên: 18/06/2014, 19:20

10 453 0
báo cáo hóa học:" Comparisons of three polyethyleneimine-derived nanoparticles as a gene therapy delivery system for renal cell carcinoma" pot

báo cáo hóa học:" Comparisons of three polyethyleneimine-derived nanoparticles as a gene therapy delivery system for renal cell carcinoma" pot

... of apoptosis Cancer Gene Ther 2010, 17:212-222 Morikawa T, Sugiyama A, Kume H, Ota S, Kashima T, Tomita K, Kitamura T, Kodama T, Fukayama M, Aburatani H: Identification of Toll-like receptor as ... physic-chemical properties (size and charge) of each separate material, including PCFC-g-PEI and FA-PEAs, as well as the FA-PEAs: pVHL complexes Because PCFC-g-PEI and FA-PEAs are amphiphilic ... cationic HPEI nanogel was conjugated by 2-kD PEI and heparin Heparin is a biodegradable negative polysaccharide with many carboxylic groups, and PEI is a cationic polymer with many primary amine...

Ngày tải lên: 20/06/2014, 03:20

10 306 0
Development and evaluation of a novel nanoparticulate delivery system of arsenic sulfides

Development and evaluation of a novel nanoparticulate delivery system of arsenic sulfides

... Indigo Naturalis tablets ( 复 方 青 黛 片 ) containing realgar, baphicanthus cusia, radix salviae mithiorrhyzae, radix pseudosatellariae, and pulverata levis to treat APL, achieving high CR rates [Huang ... treatment phase Mean age at diagnosis is about 40 years The male to female ratio is balanced [Groopman J and Ellman L, 1979] APL is characterized by rapid accumulation of immature granulocytes called ... asthma, rheumatism, haemorrhoids, cough, and pruritus, and are also prescribed as a health tonic, analgesic, anti-inflammatory agent, and as a treatment for some malignant tumors [Pan B et al., 2004]...

Ngày tải lên: 11/09/2015, 16:03

232 464 0
Development of hybrid promoters and viral vectors for improved gene delivery to the central nervous system

Development of hybrid promoters and viral vectors for improved gene delivery to the central nervous system

... emerging as a promising gene delivery agent capable of efficiently transferring genes of interest to a broad range of mammalian cell types Empirical advantages of baculoviruses as gene therapy vectors ... plasmid pAAV-MCS (Stratagene, La Jolla, CA) by a MCS-luciferase-polyA expression cassette that was PCR amplified from pGL3-basic plasmid (Promega, USA) with forward primer, 5-ATTGCGGCCGCGGTACCGAGCTCTTACG ... of AAV as a gene delivery vector are its small packaging capacity and the inconvenience of large-scale preparation of viral stock (Rabinowtz and Samulski, 1998) Baculoviruses constitute a group...

Ngày tải lên: 16/09/2015, 08:30

138 341 0
Intravesical tumor necrosis factor alpha gene therapy mediated by a novel liposome system in an orthotopic murine bladder cancer model

Intravesical tumor necrosis factor alpha gene therapy mediated by a novel liposome system in an orthotopic murine bladder cancer model

... is AJCC/UICC (Table 1.1) Traditionally, Ta and T1 papillary urothelial carcinoma are called superficial cancer and T2 and above are termed as muscle invasive cancer Table1.1: Pathological staging ... T, Esuvaranathan K Intravesical liposome-mediated tumor necrosis factor-α gene therapy in an orthotopic murine bladder cancer model, (Oral Presentation and Travel Grant Award), 6th Annual Meeting ... thanks and deepest appreciation to my supervisors: A/ P Kesavan Esuvaranathan and Dr Ratha Mahendran for their constant guidance, support and encouragement throughout this project and critical...

Ngày tải lên: 08/11/2015, 16:45

121 180 0
Báo cáo y học: " A Novel Variable Number of Tandem Repeat of the Natriuretic Peptide Precursor B gene’s 5’-Flanking Region is Associated with Essential Hypertension among Japanese Females"

Báo cáo y học: " A Novel Variable Number of Tandem Repeat of the Natriuretic Peptide Precursor B gene’s 5’-Flanking Region is Associated with Essential Hypertension among Japanese Females"

... 1145-9 Tamura N, Ogawa Y, Chusho H, et al Cardiac fibrosis in mice lacking brain natriuretic peptide Proc Natl Acad Sci USA 2000; 97: 4239-44 Mukoyama M, Nakao K, Saito Y, et al Human brain natriuretic ... Japanese Circ Res 2000; 86: 841-5 13 Nakayama T, Soma M, Rahmutula D, Ozawa Y, Kanmatsuse K Isolation of the 5'-flanking region of genes by thermal asymmetric interlaced polymerase chain reaction ... 14 Ogawa Y, Itoh H, Nakagawa O, et al Characterization of the 5'-flanking region and chromosomal assignment of the human brain natriuretic peptide gene J Mol Med 1995; 73: 457-63 15 Nakayama T,...

Ngày tải lên: 26/10/2012, 10:04

7 612 1
Research on a novel buck boost converter for wind turbine systems

Research on a novel buck boost converter for wind turbine systems

... inverters can accommodate a wide range of input dc voltage for an improved energy output from variable wind turbine resources The input source and the output grid are separated based on flyback operation ... (DCM); the averaged current of Mode is the average output current of the inverter and can be expressed as, 230 vc is the capacitor voltage and is in the same order as the grid voltage The voltage stresses ... reference wave, serving as the modulating signal, is compared with a triangular wave, serving as the carrier signal The intersection points determine the switching angles and pulse widths as in Figure...

Ngày tải lên: 03/01/2014, 19:16

6 418 0
Tài liệu A Hybrid Neural Fuzzy System for Statistical Process Control docx

Tài liệu A Hybrid Neural Fuzzy System for Statistical Process Control docx

... etc A QC can be mathematically defined as a random variable, which is a function that takes values from a population or distribution Denote a QC as random variable x If a population Ω only contains ... variation change Notice that SPC charts are designed to detect assignable causes of variation as indicated by mean or standard deviation shifts and at the same time tolerate the chance variation as shown ... statistical control charts for monitoring process variance changes Johnson and Leone (196 2a, 1962b) and Page (1963) later proposed CUSUM charts based on sample variance and sample range As an alternative,...

Ngày tải lên: 23/01/2014, 01:20

22 716 1
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... 277 283 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK *****::*.** : ... Toyobo (Osaka, Japan) Emulgen 911 was a gift from Kao Chemical (Tokyo, Japan) NADPH, NADH and NADP+ were purchased from Oriental Yeast (Tokyo, Japan) a- Cyano-4-hydroxycinnamic acid was obtained from ... :.:: : * : * NAYTAKAVIIAAGVGAFEPRRIGAPGEREFEGRGVYYAVKSKA-EFQGK-RVLIVGGGDS -EYTCDALIIATGASA -RYLGLPSEEAFKGRGVSACATCDG-FFYRNQKVAVIGGGNT LEVKARTVILAVGSRR -RKLGVPGEAELAGRGVSYCSVCDAPLFKGKDAVVVVGGGDS...

Ngày tải lên: 18/02/2014, 08:20

14 617 0
Báo cáo khoa học: Gc recruitment system incorporating a novel signal amplification circuit to screen transient protein-protein interactions pot

Báo cáo khoa học: Gc recruitment system incorporating a novel signal amplification circuit to screen transient protein-protein interactions pot

... were extracted, and the target ZI3 1A gene was amplified by PCR with primers 5¢-AAATA TAAAACGCTAGCGTCGACATGGCGC-3¢ and 5¢-AGC GTAAAGGATGGGGAAAG-3¢ The final ratio of target cells was determined by ... including global changes in transcription, a reporter gene assay and mating selection are available (Fig 1A) [12] Unlike stable interactions, however, transient interactions cannot generally transmit ... signal-amplifiable target strain (FG1; ZI3 1A Fc) and an excess amount of signal-amplifiable nontarget strain (FG0; None–Fc) Several mixing ratios were used, as shown in Table The final ratios of target...

Ngày tải lên: 05/03/2014, 23:20

9 537 0
Báo cáo khoa học: Enhanced peptide secretion by gene disruption of CYM1, a novel protease in Saccharomyces cerevisiae doc

Báo cáo khoa học: Enhanced peptide secretion by gene disruption of CYM1, a novel protease in Saccharomyces cerevisiae doc

... MATa MATa MATa MATa MATa MATa MATa MATa MATa MATa MATa MATa MATa MATa MATa MATa MATa MATa Euroscarf [16] ATCC [15] This study This study This study This study This study This study Euroscarf [16] ... Y1014 8a Y14953 Y1622 4a Y1498 4a Y17144 Y13211 Y13801 Y11941 Y11960 Y12296 Y15370 10864B Y11749 Y16248 10231B Y14266 LJY430 LJY431 LJY432 MATa MATa MATa MATa MATa MATa MATa MATa MATa MATa MATa MATa ... Total CCK [nM] Fraction Gene SwissProt ORF A1 B1 A2 B2 A1 /A2 B1/B2 AAP1 AFG3 APE 1a APE 2a APE 3a DPP3 LTA4 MIP1 PRD1 QRI7b RCA1 STE23 STE24 YBS4b YHR3b YHT2b YIK8b YIN7b YK18b YME1 MAS2 MAS1 AXL1...

Ngày tải lên: 07/03/2014, 16:20

10 632 0
Báo cáo khoa học: Construction of a novel detection system for protein–protein interactions using yeast G-protein signaling pdf

Báo cáo khoa học: Construction of a novel detection system for protein–protein interactions using yeast G-protein signaling pdf

... AAACGCCTTCGCCCAAAGTTTAAAAGATGA TCATCTTTTAAACTTTGGGCGAAGGCGTTT TTTTCTCGAGAAAGATGCCGATTTGGGCGC GGGGCTCGAGGTTTTATATTTGTTGTAAAA ATATTATATATATATATAGGGTCGTATATA AAATTATAGAAAGCAGTAGA TAAAACAATG CTTCGAAGAATATACTAAAAAATGAGCAGG ... GCCCGTCGACATATTATATATATATATAGG CCCGCTCGAGTCTTAGAATTATTGAGAACG GCCCGGATCCTGATAGTAATAGAATCCAAA CCCCGAATTCAAATTATAGAAAGCAGTAGA AAGGCTCGAGAGATCTGTTTAGCTTGCCTC AAAAGTCGACGAGCTCGTTTTCGACACTGG TTTTGTCGACATGGCGCAACACGATGAAGC ... TTTTGTCGACATGGCGCAACACGATGAAGC CGTAGACAAC GGGGGGATCCTTACATAAGCGTACAACAAA CACTATTTGATTTCGGCGCCTGAGCATCA TTTAGCTTTTT ATCCAAAGTTTAGCCGATGACCCAAGCCAA TTGGCTTGGGTCATCGGCTAAACTTTGGAT AAACGCCTTCGCCCAAAGTTTAAAAGATGA...

Ngày tải lên: 16/03/2014, 01:20

9 444 0
Báo cáo khoa học: A novel gene, fad49, plays a crucial role in the immediate early stage of adipocyte differentiation via involvement in mitotic clonal expansion docx

Báo cáo khoa học: A novel gene, fad49, plays a crucial role in the immediate early stage of adipocyte differentiation via involvement in mitotic clonal expansion docx

... Hishida et al fad49 plays a crucial role in adipogenesis KS+ (Stratagene, Agilent Technologies, Santa Clara, CA, USA) and analyzed by DNA sequencing as described below (Amersham Biosciences) and ... same way, the 3¢ region of the human cDNA of fad49 was amplified with a human fad49-specific forward primer (5¢-ACATGACCATTCCTCGAG-3¢) and reverse primer (5¢-TCTAGGCAGAAAGGGAGT-3¢) As both the amplified ... 1.0-U6 (Ambion, Inc., Austin, TX, USA) As a negative control, the scrambled fragment 5¢-GTAAGATGAGGC AATGGAG-3¢, which does not have similarity with any mRNA listed in GenBank, was generated Transfection...

Ngày tải lên: 16/03/2014, 04:20

13 385 0
Báo cáo khoa học: Cloning, characterization and localization of a novel basic peroxidase gene from Catharanthus roseus potx

Báo cáo khoa học: Cloning, characterization and localization of a novel basic peroxidase gene from Catharanthus roseus potx

... AY032675 DQ650638 AY206412 AY206413 AF244923 NA NA NA NA NA NA NA NA NA NA NA NA NA NA NA NA At5g40150 NA NA NA NA NA NA NA NA NA NA NA NA At5g05340 NA NA NA NA NA NA NA NA NA Unpublished Unpublished ... cotton (COTPROXDS) (AAA99868), barley grain (BP1) (AAA32973), Ar thaliana (ATP 2A) A2 (Q42578) and HRP-C (AAA33377) Residue numbers start at the putative mature proteins by analogy with HRP-C Preprotein ... Analysis and expression of the class III peroxidase large gene family in Arabidopsis thaliana Gene 288, 129–138 Tanaka S, Ikeda K, Ono M & Miyasaka H (2002) Isolation of several anti-stress genes...

Ngày tải lên: 23/03/2014, 09:21

14 347 0
Báo cáo khoa học: A novel pathway for sequential transformation of 7-dehydrocholesterol and expression of the P450scc system in mammalian skin pptx

Báo cáo khoa học: A novel pathway for sequential transformation of 7-dehydrocholesterol and expression of the P450scc system in mammalian skin pptx

... AAATTGGCGACTCTCTGCTAG CTTGCTCATGTCAACAGACTG CTTGGAGTCATCCCCAACAC TGGCCTCGAGAGACTTCCTC AGACTTCTTTCGACTCCTCAG CTGAAGTTCTCCAGCAGATTG CYP1 1A P561 P562 Mouse genes FDX1 FDXR CYP1 1A 10 380 Exon Exon ... sequences Gene FDXR Primer sequences Primer location Amplified band (bp) P553 P554 P557 P558 GTGATTCTCTGCTAGATGTTG GGCACTCGAACAGTCATATTG ATTAAGGAGCTTCGGGAGATG CTCTTATACCCAATGCTGCTG First pair GCCTTTGAGTCCATCACTAAC ... GCCTTTGAGTCCATCACTAAC CCAGTGTCTTGGCAGGAATC Nested pair ATGTGGCTGCATGGGACGTG TCTGCAGGGTCACGGAGATG Exon Exon Exon Exon 257 P563 P564 Human genes FDX1 Primers P581 P582 P583 P584 P585 P586 AAATTGGCGACTCTCTGCTAG...

Ngày tải lên: 23/03/2014, 13:20

11 476 0
Báo cáo khoa học: The Promyelocytic Leukemia Zinc Finger (PLZF ) gene is a novel transcriptional target of the CCAAT-DisplacementProtein (CUX1) repressor ppt

Báo cáo khoa học: The Promyelocytic Leukemia Zinc Finger (PLZF ) gene is a novel transcriptional target of the CCAAT-DisplacementProtein (CUX1) repressor ppt

... primer (5¢-aaatgtcttgaccagccgtc-3¢) and Chip2dw primer (5¢-gaaacaaaggcctctcccag-3¢); Chip3up primer (5¢-gctttgcagtcagaatggtc-3¢) and Chip3dw primer (5¢-ctgagcactgactacgaaac-3¢) The Chip1up and Chip1dw ... MG_U74Av2 GeneChips (Affymetrix, Santa Clara, CA, USA), followed by microarray analysis as described elsewhere [51] Microarray Analysis Suite 5.0 (MAS, Affymetrix) was used to quantify microarray ... Seattle, WA, USA) that targeted a conserved sequence in rat, mouse and human CUX1 was kindly provided by Dr Julian Downward [50] Two bases (in capitals) were further mutated (5¢-aagaaga acaGAccagaggattt-3¢)...

Ngày tải lên: 29/03/2014, 21:20

13 359 0
w