Báo cáo khoa học: Spermosin, a trypsin-like protease from ascidian sperm cDNA cloning, protein structures and functional analysis doc

Báo cáo khoa học: Spermosin, a trypsin-like protease from ascidian sperm cDNA cloning, protein structures and functional analysis doc

Báo cáo khoa học: Spermosin, a trypsin-like protease from ascidian sperm cDNA cloning, protein structures and functional analysis doc

... Spermosin, a trypsin-like protease from ascidian sperm cDNA cloning, protein structures and functional analysis Eri Kodama 1 , Tadashi Baba 2 , Nobuhisa Kohno 2 , Sayaka Satoh 2 , Hideyoshi ... fertilization experiments are more a ccessible than those in mammals, and large amounts of s perm and egg are obtainable from thousands of these animals which are cu...

Ngày tải lên: 17/03/2014, 11:20

7 493 0
Tài liệu Báo cáo khoa học: Interferon-a induces sensitization of cells to inhibition of protein synthesis by tumour necrosis factor-related apoptosis-inducing ligand ppt

Tài liệu Báo cáo khoa học: Interferon-a induces sensitization of cells to inhibition of protein synthesis by tumour necrosis factor-related apoptosis-inducing ligand ppt

... Shigeno M, Nako K, Ichikawa T, Suzuki K, Kawakami A, Abiru S, Miyazoe S, Nakagawa Y, Ishikawa H, Hamasaki K et al. (2003) Interferon -a sensitizes human hepatoma cells to TRAIL-induced apoptosis ... 40760–40767. 34 Yamada H, Tada-Oikawa S, Uchida A & Kawanishi S (1999) TRAIL causes cleavage of bid by caspase-8 and loss of mitochondrial membrane potential resulting in apoptosis in BJ...

Ngày tải lên: 19/02/2014, 06:20

11 679 0
Báo cáo khoa học: Benzo[a]pyrene impairs b-adrenergic stimulation of adipose tissue lipolysis and causes weight gain in mice A novel molecular mechanism of toxicity for a common food pollutant doc

Báo cáo khoa học: Benzo[a]pyrene impairs b-adrenergic stimulation of adipose tissue lipolysis and causes weight gain in mice A novel molecular mechanism of toxicity for a common food pollutant doc

... unlike b-adrenergic and ACTH receptors that contain seven transmembrane spanning domains, the ANP receptor (NPR -A) is a guanyl cyclase that contains only a single transmembrane spanning domain [27]. We ... Body weight and food intake of animals housed in pairs were measured daily at 09.00, i.e. immediately after the dark cycle. (C) and (D) show the average weight gain ± SEM and t...

Ngày tải lên: 30/03/2014, 11:20

11 425 0
Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc

Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc

... RRHEDLLHGP-HA Beta HPWGQRQRQEVGSEAGSLLPQPRAALPQLSG-LDP RRDYHSVRRPDVLLHSAHHG Gamma QQAWPGRQSQEGAGLPSHHGRPAGLLPHLSG-LEAGAVSARRDAY RRSDLLLPHAHAL Epsilon QAAWAAPRAAARAHEE PPGLLAPPARALG-LDP RRDYA TAVPRLLHGLADG ... was shown that the broad-complex, tramtrack and bric -a- brac domain containing protein KCTD1 directly binds to AP- 2a and acts as a negative regulator for AP- 2a trans- act...

Ngày tải lên: 16/02/2014, 09:20

9 643 0
Tài liệu Báo cáo khoa học: Multidentate pyridinones inhibit the metabolism of nontransferrin-bound iron by hepatocytes and hepatoma cells docx

Tài liệu Báo cáo khoa học: Multidentate pyridinones inhibit the metabolism of nontransferrin-bound iron by hepatocytes and hepatoma cells docx

... and novel tetradentate and hexadentate analogues on NTBI uptake and mobilization from rat hepatocytes and hepatoma cells. DFO was included as a reference chelator. Materials and methods Animals Hepatocytes ... methylamine was from BDH Chemicals, Australia. All other chemicals were of analytical reagent quality and purchased from Sigma or Ajax (Sydney, Australia). Chelators...

Ngày tải lên: 20/02/2014, 11:20

10 545 0
Báo cáo khoa học: Plant oxylipins: role of jasmonic acid during programmed cell death, defence and leaf senescence doc

Báo cáo khoa học: Plant oxylipins: role of jasmonic acid during programmed cell death, defence and leaf senescence doc

... GENEVESTIGATOR. Arabidop- sis microarray database and analysis toolbox. Plant Physiol 136, 2621–2632. 165 Tsuchiya T, Ohta H, Okawa K, Iwamatsu A, Shi- mada H, Masuda T & Takamiya K-I (1999) ... contributes to OPDA and JA synthesis [34]. By contrast, fractions of the unsaturated membrane fatty acid a- linolenic acid and a- linoleic acid are converted randomly and nonenzymatic...

Ngày tải lên: 16/03/2014, 02:20

16 488 0
Báo cáo khoa học: pyr RNA binding to the Bacillus caldolyticus PyrR attenuation protein – characterization and regulation by uridine and guanosine nucleotides potx

Báo cáo khoa học: pyr RNA binding to the Bacillus caldolyticus PyrR attenuation protein – characterization and regulation by uridine and guanosine nucleotides potx

... native and the G72 3A and G72 6A sequence variants of BcBL2 indicate that the effects on affinity observed previously for native BsBL2 and its structural variants [2] are valid, at least qualitatively. ... His-tagged PyrR and a partial specific volume of 0.7450 cm 3 Æg )1 was calculated from the sequence of the native protein; an approximate value for RNA (0.51 cm 3 Æg )1 ) was o...

Ngày tải lên: 16/03/2014, 06:20

16 309 0
Báo cáo khoa học: Mycobacterium tuberculosis H37Rv ESAT-6–CFP-10 complex formation confers thermodynamic and biochemical stability docx

Báo cáo khoa học: Mycobacterium tuberculosis H37Rv ESAT-6–CFP-10 complex formation confers thermodynamic and biochemical stability docx

... hairpin conformation and are orientated antiparallel to each other. The contact sur- face between ESAT-6 and CFP-10 is primarily hydro- phobic, and van der Waals interactions between ESAT-6 and ... endonucleases, T4 DNA ligase and DNA size markers were from New England Bio- labs (Beverly, MA, USA). Taq polymerase and other rea- gents for PCR, and the Plasmid Miniprep kit, the...

Ngày tải lên: 30/03/2014, 11:20

18 432 0
Tài liệu Báo cáo khoa học: TMPRSS13, a type II transmembrane serine protease, is inhibited by hepatocyte growth factor activator inhibitor type 1 and activates pro-hepatocyte growth factor pdf

Tài liệu Báo cáo khoa học: TMPRSS13, a type II transmembrane serine protease, is inhibited by hepatocyte growth factor activator inhibitor type 1 and activates pro-hepatocyte growth factor pdf

... Tsubouchi H, Naka D, Takahashi K, Okigaki M, Arakaki N, Nakayama H, Hirono S, Sakiy- ama O, Takahashi K et al. (1989) Molecular cloning and sequence analysis of cDNA for human hepatocyte growth factor. ... Yokohama, Japan 2 Advanced Medical Research Laboratory, Mitsubishi Tanabe Pharma Corporation, Kamoshida-cho, Aoba-ku, Yokohama, Japan Introduction Type II transmembrane serine proteas...

Ngày tải lên: 15/02/2014, 01:20

13 641 0
Báo cáo khoa học: Macrocypins, a family of cysteine protease inhibitors from the basidiomycete Macrolepiota procera pot

Báo cáo khoa học: Macrocypins, a family of cysteine protease inhibitors from the basidiomycete Macrolepiota procera pot

... cysteine proteases papain, cathepsin L and cathepsin V using benzyloxycar- bonyl (Z)-Phe-Arg-7-amido-4-methylcoumarin (AMC) as substrate, and for legumain with Z-Ala-Ala-Asn-AMC as the substrate, ... Supplementary Data in Doc. S1 and Doc. S2 and Fig. S1 and S2). Cloning and analysis of macrocypin cDNA and gene sequences The N-terminal sequence (H 2 N-GLEDGLYTIRHLVE GQPPNIP...

Ngày tải lên: 16/03/2014, 02:20

12 368 0
w