Báo cáo khoa học: A novel mass spectrometric approach to the analysis of hormonal peptides in extracts of mouse pancreatic islets ppt
... A novel mass spectrometric approach to the analysis of hormonal peptides in extracts of mouse pancreatic islets Margareta Ramstro¨m 1 , Charlotte Hagman 2 , Youri O. Tsybin 2 , Karin E. Markides 1 , ... scans, 512 K data points was collected. The spectrum was calibrated using a dataset of a sample of standard pep- tides. After calibration, the mas...
Ngày tải lên: 17/03/2014, 10:20
... database (release 48.8) with fixed carbamidomethyl modification of cysteine residues, vari- able oxidation of methionine and variable deamidation of asparagine and glutamine. Parent and fragment mass ... protease proteomic approach applied to meprin, an astacin-like metalloendopeptidase, to determine physiological substrates in a cell-based system of Madin–Darby canine kidne...
Ngày tải lên: 07/03/2014, 06:20
... that pattern-based inference is also necessary. The relations of adjacent structure can infer the relations of separated structure if there are certain linguistic indicators in the local context. ... training data (with true entities) where 6 types and 18 subtypes of relations are annotated. We use 75% of it to train SVM classifiers and the remaining to evaluate r...
Ngày tải lên: 20/02/2014, 09:20
Báo cáo khoa học: A novel metallocarboxypeptidase-like enzyme from the marine annelid Sabellastarte magnifica – a step into the invertebrate world of proteases pdf
... Urochordata, Echinodermata, Cnidaria, Mollusca, Artropoda) were collected in the north coast of Havana and classified by Cuban specialists at the National Institute of Oceanology (Havana, Cuba). The ... granulifera, Cassiopea xamachana, Condylactys gigantea, Gorgonia ventalina, Lebrunia danae, Palythoa caribaeorum, Physalia phy- salis, Plexaura homomalla, Stichodactyla helianthus a...
Ngày tải lên: 07/03/2014, 02:20
Báo cáo khoa học: "A Novel Word Segmentation Approach for Written Languages with Word Boundary Markers" pptx
... stages. For written languages that have WBMs, such as for the Korean language, the majority of recent research has been based on a traditional WS ap- proach (Nakagawa, 2004). The first step of the traditional ... the traditional approach is to eliminate all spaces in the user input, and then re-locate the proper places to insert WBMs. One state -of -the- art Korean...
Ngày tải lên: 17/03/2014, 02:20
Tài liệu Báo cáo khoa học: A knowledge-based potential function predicts the specificity and relative binding energy of RNA-binding proteins ppt
... the performance of the potential will only increase with the size of the structural database and as terms are added to the model to account for protein and RNA intra-molecular interactions that are ... quantify the character- istics of protein–RNA interactions using computational approaches [17]. Here, we present a new approach for predicting the specificity of RN...
Ngày tải lên: 18/02/2014, 16:20
Tài liệu Báo cáo khoa học: "A Logic-based Semantic Approach to Recognizing Textual Entailment" ppt
... electoral campaign is held in Nicaragua from Nicaraguan electoral campaign. We ensured the relevance of the lexical chains by limiting the path length to three relations and the set of WordNet relations ... used to create the chains by discarding the paths that contain certain relations in a particular order. For example, the automatic axiom generation module does...
Ngày tải lên: 20/02/2014, 12:20
Báo cáo khoa học: A steady-state modeling approach to validate an in vivo mechanism of the GAL regulatory network in Saccharomyces cerevisiae ppt
... individual m echanisms in the overall hierarchy is limited to a subset of the total in vivo interactions. Quantitative analyses have been used to integrate the metabolic pathways for signal t ransduction and ... expression. The status of the switch is determined by the state of the upstream regulatory element of the GAL genes in the nucleus. The regulat...
Ngày tải lên: 07/03/2014, 16:20
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... b-cryptoxanthin [10]. The zeaxanthin produced by CYP17 5A1 is used as an inter- mediate for the synthesis of thermozeaxanthins and thermobiszeaxanthins, which are the main carotenoids of T. thermophilus ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAV...
Ngày tải lên: 18/02/2014, 08:20
Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx
... 5¢-AAGTAGGCGGAGTATCGAAC-3¢ (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT ACTT-3¢ (antisense). Caspase 3 activity Cells ... occludin (Occ WT ) and variant occludin in apoptosis and invasion, as determined by assay, we revealed that exon 9 played a major role in the induc- tion of mi...
Ngày tải lên: 18/02/2014, 18:20