Báo cáo khoa học: A simple in vivo assay for measuring the efficiency of gene length-dependent processes in yeast mRNA biogenesis doc

Báo cáo khoa học: A simple in vivo assay for measuring the efficiency of gene length-dependent processes in yeast mRNA biogenesis doc

Báo cáo khoa học: A simple in vivo assay for measuring the efficiency of gene length-dependent processes in yeast mRNA biogenesis doc

... The Authors Journal compilation ª 2006 FEBS 769 A simple in vivo assay for measuring the efficiency of gene length-dependent processes in yeast mRNA biogenesis Macarena Morillo-Huesca, Manuela Vanti ... (2001) Mutations in the TATA-binding pro- tein, affecting transcriptional activation, show synthetic lethality with the TAF145 gene lacking the TAF...

Ngày tải lên: 07/03/2014, 12:20

14 435 0
Báo cáo khoa học: " A simple pattern-matching algorithm for recovering empty nodes and their antecedents∗" pot

Báo cáo khoa học: " A simple pattern-matching algorithm for recovering empty nodes and their antecedents∗" pot

... visit- ing all of the subtrees of the tree concerned. It can also be regarded as a kind of tree transformation, so the overall system architecture (including the parser) is an instance of the “transform-detransform” ... displayed in Figure 1. accuracy of transitivity labelling was not systemati- cally evaluated here. 2.2 Patterns and matchings Informally, patterns are...

Ngày tải lên: 17/03/2014, 08:20

8 347 0
Báo cáo khoa học: "A Simple, Similarity-based Model for Selectional Preferences" pdf

Báo cáo khoa học: "A Simple, Similarity-based Model for Selectional Preferences" pdf

... require any manually created lexical resources. In addition, the corpus for computing the similarity metrics can be freely chosen, allowing greater variation in the domain of generalization than a ... isolated compar- isons of the two generalization paradigms that we are aware of, Gildea and Jurafsky’s (2002) task-based evaluation has found clustering- based approaches to...

Ngày tải lên: 23/03/2014, 18:20

8 498 0
Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc

Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc

... [6,8,27] or to any other sequences available in FASTA and BLAST database programs at the DNA Data Bank of Jap an. Recently, we reported the cloning and s equencing of the gene encoding 4-amino-3-hydroxybenzoate ... enzyme assay revealed the mechanism of the deamination reaction and the subsequent metabolism, including the deamination step. The product formed from 4...

Ngày tải lên: 19/02/2014, 16:20

7 613 1
Báo cáo khoa học: A simple protocol to study blue copper proteins by NMR pot

Báo cáo khoa học: A simple protocol to study blue copper proteins by NMR pot

... for the analysis of all NMR spectra. Theory A classical approach toward structure determination in a paramagnetic metalloprotein does not provide information in the proximity of the metal center ... summarizes the information obtained using modified CBCA(CO)NH and CBCANH. Assignment of fast relaxing signals The assignment of the new signals found in the tailor...

Ngày tải lên: 08/03/2014, 08:20

10 573 0
Báo cáo khoa học: "A Class-Based Agreement Model for Generating Accurately Inflected Translations" pptx

Báo cáo khoa học: "A Class-Based Agreement Model for Generating Accurately Inflected Translations" pptx

... The inputs are a translation hypothesis e I 1 , an index n distinguishing the prefix from the attachment, and a flag indicating if their concatenation is a goal hypothesis. The beam search maintains ... English-Arabic translation as an example of a translation direction that expresses substantially more morphological information in the target. These relations are best capt...

Ngày tải lên: 16/03/2014, 19:20

10 414 0
Báo cáo khoa học: "A Simple Measure to Assess Non-response" docx

Báo cáo khoa học: "A Simple Measure to Assess Non-response" docx

... higher than the sum resulting from the scores of incorrect answers. This could explain the little success of this measure for evaluating QA systems in favor, again, of accuracy measure. Accuracy is the ... technologies (Pe ˜ nas et al., 2007). The starting point was the re- formulation of Answer Validation as a Recognizing Textual Entailment problem, under the assu...

Ngày tải lên: 17/03/2014, 00:20

10 349 0
Báo cáo khoa học: "A Probabilistic Context-free Grammar for Disambiguation in Morphological Parsing" pdf

Báo cáo khoa học: "A Probabilistic Context-free Grammar for Disambiguation in Morphological Parsing" pdf

... onverdraagzaam (intoler- ant) and, finally, nominal suffixation yields the noun onverdraagzaamheid (intolerance): (7) N A A\N A/ A A heid on V V \A V/V V zaam I I ver draag Also, the ... appropriateness of the training set: for one thing, it must have a reasonable size and be representative of the domain that is being modelled. Our training set was the...

Ngày tải lên: 18/03/2014, 02:20

10 435 0
Báo cáo khoa học: "A SIMPLE BUT USEFUL APPROACH TO CONJUNCT IDENTIFICATION" docx

Báo cáo khoa học: "A SIMPLE BUT USEFUL APPROACH TO CONJUNCT IDENTIFICATION" docx

... exploring the automation of extraction of information from structured reference manuals. The largest manual available to the project in machine-readable form is the Merck Veterinary Manual, ... noun phrase is the label associated with the head noun of the noun phrase. In some instances, a preceding adjective influences the case label of the noun phrase,...

Ngày tải lên: 23/03/2014, 20:20

7 234 0
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... the synthesis of thermozeaxanthins and thermobiszeaxanthins, which are the main carotenoids of T. thermophilus [15]. The insertion of thermozeax- anthins and thermobiszeaxanthins into the cell ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAY...

Ngày tải lên: 18/02/2014, 08:20

14 617 0
w