Tài liệu Báo cáo Y học: A pool of Y2 neuropeptide Y receptors activated by modifiers of membrane sulfhydryl or cholesterol balance pot

... that are generated from an online Encyclopedia (in our case Wikipedia). The relevant background relation graph is also represented as a touchable graph in the same way as a topic graph. The major ... touch on a node to display the associated snippets and web pages. Since a topic graph can be very large, not all nodes are displayed. Nodes, which can be expanded are marked by the numb...

Ngày tải lên: 20/02/2014, 05:20

... inhibitor was less than 5% of control values. Ó FEBS 2002 Masked Y2 NPY receptors (Eur. J. Biochem. 269) 2319 PRIORITY PAPER A pool of Y2 neuropeptide Y receptors activated by modifiers of membrane sulfhydryl ... temperature (Fig. 5A) . A similar fast activation was observed for Y2 receptors of rat forebrain cells (not shown). This was contrasted by a...

Ngày tải lên: 22/02/2014, 04:20

... Adelaide, North Terrace, Adelaide, South Australia, Australia Vascular endothelial growth factor (VEGF) is a key regu- lator of angiogenesis and post-transcriptional regulation plays a major role in VEGF ... and 46) were then imme- diately added and RNase T1 digested complexes analyzed by gel shift assay. Cytoplasmic complexes CC4 4a, CC44b and CC46 and unbound RNA probe are indicated...

Ngày tải lên: 19/02/2014, 12:20

... information for the functional analysis of plant DEVH box RNA helicases, and suggest that AtHELPS, as an impor- tant negative regulator, plays a role in K + deprivation stress. Abbreviations ABA, ... HH, Tian X, Li YJ, Wu CA & Zheng CC (2008) Microarray-based analysis of stress-regulated micro- RNAs in Arabidopsis thaliana. RNA 14, 1–8. 58 Xue H, Yang YT, Wu CA, Yang GD, Zhang MM &a...

Ngày tải lên: 14/02/2014, 18:20

... Hamaguchi T, Iizuka N, Tsunedomi R, Hamamoto Y, Miyamoto T, Iida M, Tokuhisa Y, Sakamoto K, Taka- shima M, Tamesa T et al. (2008) Glycolysis module activated by hypoxia-inducible factor 1alpha ... Miyazaki A, Nabeta Y, Hiroh- ashi Y, Kanaseki T, Yamaguchi A, Yamada N, Hiray- ama K, Suzuki M et al. (2002) Natural antigenic peptides from squamous cell carcinoma recognized by autolo...

Ngày tải lên: 14/02/2014, 19:20

... Experi- mental procedures, the rate of assimilate export from photosynthetically active source organs to consuming sink organs or metabolic pathways other than carbo- hydrate pathways was calculated as ... slightly lower mean rates of carbon uptake before and during the first day of cold acclimation. After 3 days of cold exposure, the mean rate of carbon uptake was significantly low...

Ngày tải lên: 14/02/2014, 22:20

... I, Akinaga A, Kitano H, Yokoyama K, Satomura M, Kurosawa T, Watanabe M, Kawabata T, Chang W et al. (2009) Automated immunoassay system for AFP-L3% using on-chip electrokinetic reaction and separation ... development of better tools for glycan analysis by MS n techniques. We are currently building a spectral library of gly- can structures by measuring MS n spectra of a variety...

Ngày tải lên: 16/02/2014, 08:20

... for the mRNA of b-catenin were 5¢-AAAGCTGATATTGATGGACAG-3¢. The siRNA against luciferase mRNA was used as a control siRNA. The target sequence for luciferase mRNA was 5¢-AACG TACGCGGAATACTTCGA-3¢. ... Dasgupta C, Sakurai R, Wang Y, Guo P, Ambalava- nan N, Torday JS & Rehan VK (2009) Hyperoxia- induced neonatal rat lung injury involves activation of TGF-b and Wnt signaling, protecti...

Ngày tải lên: 18/02/2014, 06:20

... ob mice and genetically matched lean mice. Levels of miRNA expres- sion were analyzed by TaqMan quantitative PCR. Data are mean value ± standard errors of the mean from four individual mice of each ... and was regulated by hypoxia, an important extracellular stress associated with obesity. Our data strongly suggest that miR-27 represents a new class of adipogenic inhibitors and...

Ngày tải lên: 18/02/2014, 08:20

... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... (http://align.genome.jp/). Acknowledgements This study was partially supported by a Grant-in-Aid for Exploratory Research from the Japan Society for the Promotion of Science and a...

Ngày tải lên: 18/02/2014, 08:20