Tài liệu Báo cáo Y học: A pool of Y2 neuropeptide Y receptors activated by modifiers of membrane sulfhydryl or cholesterol balance pot

Tài liệu Báo cáo khoa học: "A Mobile Touchable Application for Online Topic Graph Extraction and Exploration of Web Content" ppt

Tài liệu Báo cáo khoa học: "A Mobile Touchable Application for Online Topic Graph Extraction and Exploration of Web Content" ppt

... that are generated from an online Encyclopedia (in our case Wikipedia). The relevant background relation graph is also represented as a touchable graph in the same way as a topic graph. The major ... touch on a node to display the associated snippets and web pages. Since a topic graph can be very large, not all nodes are displayed. Nodes, which can be expanded are marked by the numb...

Ngày tải lên: 20/02/2014, 05:20

6 458 0
Tài liệu Báo cáo Y học: A pool of Y2 neuropeptide Y receptors activated by modifiers of membrane sulfhydryl or cholesterol balance pot

Tài liệu Báo cáo Y học: A pool of Y2 neuropeptide Y receptors activated by modifiers of membrane sulfhydryl or cholesterol balance pot

... inhibitor was less than 5% of control values. Ó FEBS 2002 Masked Y2 NPY receptors (Eur. J. Biochem. 269) 2319 PRIORITY PAPER A pool of Y2 neuropeptide Y receptors activated by modifiers of membrane sulfhydryl ... temperature (Fig. 5A) . A similar fast activation was observed for Y2 receptors of rat forebrain cells (not shown). This was contrasted by a...

Ngày tải lên: 22/02/2014, 04:20

8 469 1
Tài liệu Báo cáo khóa học: A multi-protein complex containing cold shock domain (Y-box) and polypyrimidine tract binding proteins forms on the vascular endothelial growth factor mRNA Potential role in mRNA stabilization pptx

Tài liệu Báo cáo khóa học: A multi-protein complex containing cold shock domain (Y-box) and polypyrimidine tract binding proteins forms on the vascular endothelial growth factor mRNA Potential role in mRNA stabilization pptx

... Adelaide, North Terrace, Adelaide, South Australia, Australia Vascular endothelial growth factor (VEGF) is a key regu- lator of angiogenesis and post-transcriptional regulation plays a major role in VEGF ... and 46) were then imme- diately added and RNase T1 digested complexes analyzed by gel shift assay. Cytoplasmic complexes CC4 4a, CC44b and CC46 and unbound RNA probe are indicated...

Ngày tải lên: 19/02/2014, 12:20

13 604 0
Tài liệu Báo cáo khoa học: A DExD⁄ H box RNA helicase is important for K+ deprivation responses and tolerance in Arabidopsis thaliana docx

Tài liệu Báo cáo khoa học: A DExD⁄ H box RNA helicase is important for K+ deprivation responses and tolerance in Arabidopsis thaliana docx

... information for the functional analysis of plant DEVH box RNA helicases, and suggest that AtHELPS, as an impor- tant negative regulator, plays a role in K + deprivation stress. Abbreviations ABA, ... HH, Tian X, Li YJ, Wu CA & Zheng CC (2008) Microarray-based analysis of stress-regulated micro- RNAs in Arabidopsis thaliana. RNA 14, 1–8. 58 Xue H, Yang YT, Wu CA, Yang GD, Zhang MM &a...

Ngày tải lên: 14/02/2014, 18:20

11 786 0
Tài liệu Báo cáo khoa học: a-enolase: a promising therapeutic and diagnostic tumor target ppt

Tài liệu Báo cáo khoa học: a-enolase: a promising therapeutic and diagnostic tumor target ppt

... Hamaguchi T, Iizuka N, Tsunedomi R, Hamamoto Y, Miyamoto T, Iida M, Tokuhisa Y, Sakamoto K, Taka- shima M, Tamesa T et al. (2008) Glycolysis module activated by hypoxia-inducible factor 1alpha ... Miyazaki A, Nabeta Y, Hiroh- ashi Y, Kanaseki T, Yamaguchi A, Yamada N, Hiray- ama K, Suzuki M et al. (2002) Natural antigenic peptides from squamous cell carcinoma recognized by autolo...

Ngày tải lên: 14/02/2014, 19:20

11 722 0
Tài liệu Báo cáo khoa học: A systems biology approach for the analysis of carbohydrate dynamics during acclimation to low temperature in Arabidopsis thaliana doc

Tài liệu Báo cáo khoa học: A systems biology approach for the analysis of carbohydrate dynamics during acclimation to low temperature in Arabidopsis thaliana doc

... Experi- mental procedures, the rate of assimilate export from photosynthetically active source organs to consuming sink organs or metabolic pathways other than carbo- hydrate pathways was calculated as ... slightly lower mean rates of carbon uptake before and during the first day of cold acclimation. After 3 days of cold exposure, the mean rate of carbon uptake was significantly low...

Ngày tải lên: 14/02/2014, 22:20

13 708 0
Tài liệu Báo cáo khoa học: A strategy for discovery of cancer glyco-biomarkers in serum using newly developed technologies for glycoproteomics ppt

Tài liệu Báo cáo khoa học: A strategy for discovery of cancer glyco-biomarkers in serum using newly developed technologies for glycoproteomics ppt

... I, Akinaga A, Kitano H, Yokoyama K, Satomura M, Kurosawa T, Watanabe M, Kawabata T, Chang W et al. (2009) Automated immunoassay system for AFP-L3% using on-chip electrokinetic reaction and separation ... development of better tools for glycan analysis by MS n techniques. We are currently building a spectral library of gly- can structures by measuring MS n spectra of a variety...

Ngày tải lên: 16/02/2014, 08:20

11 854 0
Tài liệu Báo cáo khoa học: a-Defensins increase lung fibroblast proliferation and collagen synthesis via the b-catenin signaling pathway doc

Tài liệu Báo cáo khoa học: a-Defensins increase lung fibroblast proliferation and collagen synthesis via the b-catenin signaling pathway doc

... for the mRNA of b-catenin were 5¢-AAAGCTGATATTGATGGACAG-3¢. The siRNA against luciferase mRNA was used as a control siRNA. The target sequence for luciferase mRNA was 5¢-AACG TACGCGGAATACTTCGA-3¢. ... Dasgupta C, Sakurai R, Wang Y, Guo P, Ambalava- nan N, Torday JS & Rehan VK (2009) Hyperoxia- induced neonatal rat lung injury involves activation of TGF-b and Wnt signaling, protecti...

Ngày tải lên: 18/02/2014, 06:20

12 602 0
Tài liệu Báo cáo khoa học: A role of miR-27 in the regulation of adipogenesis ppt

Tài liệu Báo cáo khoa học: A role of miR-27 in the regulation of adipogenesis ppt

... ob mice and genetically matched lean mice. Levels of miRNA expres- sion were analyzed by TaqMan quantitative PCR. Data are mean value ± standard errors of the mean from four individual mice of each ... and was regulated by hypoxia, an important extracellular stress associated with obesity. Our data strongly suggest that miR-27 represents a new class of adipogenic inhibitors and...

Ngày tải lên: 18/02/2014, 08:20

11 850 0
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... (http://align.genome.jp/). Acknowledgements This study was partially supported by a Grant-in-Aid for Exploratory Research from the Japan Society for the Promotion of Science and a...

Ngày tải lên: 18/02/2014, 08:20

14 617 0
w